Yun Wu

Wannan Medical College

Author Statistics

Papers

Citation

H-Index

i-10 index

Research Trends

Author Order

Document Type

Co-Authors

Maojun Zhou

Xiangya Hospital Central South University

Yuanyuan Qiang

Ningxia Medical University

Anlong Xu

Southern Marine Science and Engineering Guangdong Laboratory (Guangzhou)

Zhenghua Ren

Air Force Medical University

Xiaoyan Zhu

Sun Yat-sen University

Yuchao Feng

Heilongjiang Bayi Agricultural University

Lei Wang

Guangxi Medical University

Guang‐Xian Zhang

Thomas Jefferson University

Hao Lin

University of Electronic Science and Technology of China

Yongsheng Tao

Northwest A&F University

Cooperative Institutions

Sun Yat-sen University

Chinese Academy of Sciences

Northwest A&F University

Chinese Academy of Medical Sciences & Peking Union Medical College

Peking Union Medical College Hospital

Ministry of Agriculture and Rural Affairs

Wuhan University

Southwest University

Sichuan University

Ningxia Medical University

Author Statistics

Papers

Citation

H-Index

i-10 index

Research Field

Molecular Evolution and Diversity of Conus Peptide Toxins, as Revealed by Gene Structure and Intron Sequence Analyses

PLoS ONE (2013)

Yun Wu Lei Wang Maojun Zhou Yuwen You Xiaoyan Zhu

Cone snails, which are predatory marine gastropods, produce a cocktail of venoms used for predation, defense and competition. The major venom component, conotoxin, has received significant attention because it is useful in neuroscience research, drug development and molecular diversity studies. In this study, we report the genomic characterization of nine conotoxin gene superfamilies from 18 Conus species and investigate the relationships among conotoxin gene structure, molecular evolution and diversity. The I1, I2, M, O2, O3, P, S, and T superfamily precursors all contain three exons and two introns, while A superfamily members contain two exons and one intron. The introns are conserved within a certain gene superfamily, and also conserved across different Conus species, but divergent among different superfamilies. The intronic sequences contain many simple repeat sequences and regulatory elements that may influence conotoxin gene expression. Furthermore, due to the unique gene structure of conotoxins, the base substitution rates and the number of positively selected sites vary greatly among exons. Many more point mutations and trinucleotide indels were observed in the mature peptide exon than in the other exons. In addition, the first example of alternative splicing in conotoxin genes was found. These results suggest that the diversity of conotoxin genes has been shaped by point mutations and indels, as well as rare gene recombination or alternative splicing events, and that the unique gene structures could have made a contribution to the evolution of conotoxin genes.

Conotoxin

Conus

Indel

10.1371/journal.pone.0082495

Cite

Citations (31)

Synthesis and evaluation of a novel analgesic conotoxin Lt7b that inhibits calcium currents and increases sodium currents

Journal of Cellular and Molecular Medicine (2022)

Yun Wu Manyi Yang Yubin Li Wei Zhang Maojun Zhou

Conotoxins are promising neuropharmacological tools and drug candidates due to their high efficiency and specificity in targeting ion channels or neurotransmitter receptors. In this study, a novel O2 -superfamily conotoxin, Lt7b, was synthesized and its pharmacological functions were evaluated. Lt7b with three modified amino acids and three disulfide bonds was successfully synthesized. CD spectra showed that Lt7b had a typical α-helix in the secondary structure. Patch clamp experiments on rat DRG neurons showed that Lt7b could significantly inhibit calcium currents with an IC50 value of 856 ± 95 nM. Meanwhile, 10 μM Lt7b could significantly increase the sodium currents by 77 ± 8%, but it had no obvious effects on the potassium currents in DRG neurons. In addition, patch clamp experiments on ion channel subtypes showed that 10 μM Lt7b could inhibit 7.0 ± 1.2%, 8.0 ± 1.5%, 4.6 ± 3.4%, and 9.5 ± 0.1% of the hCav 1.2, hCav 2.1, hCav 2.2, and hCav 3.2 currents, respectively, while it did not increase the rNav 1.7, rNav 1.8, hNav 1.5, hNav 1.7, and hNav 1.8 currents. Lt7b had no obvious toxicity to HaCaT and ND7/23 cells up to 1 mM and significantly increased the pain threshold at the testing time of 0.5-4 h in a dose-dependent manner in the mouse hotplate assay. This novel conotoxin Lt7b may be a useful tool for ion channel studies and analgesic drug development.

Conotoxin

10.1111/jcmm.17521

Cite

Citations (3)

Soluble expression, purification and functional identification of the framework XV conotoxins derived from different Conus species

Peptides (2014)

Yun Wu Lei Wang Maojun Zhou Xiuhua Jiang Xiaoyan Zhu

Conotoxin

Conus

Indel

10.1016/j.peptides.2014.03.018

Cite

Citations (11)

Ultrasound-assisted metabolite detection in different extraction processes of Bletilla striata and bitter metabolite detection

Ultrasonics Sonochemistry (2025)

Juan Zhou Yu‐Qi Feng Wenhao Zhou Mengying Zhang Falin Liu

Bletilla striata, a medicinal orchidaceous plant, is recognized for its significant pharmacological value. However, the lack of comparative metabolomic data across different extraction methods for analyzing its bioactive components has significantly undervalued the application potential of B. striata in the traditional Chinese medicine market. Using six ultrasound-assisted extraction methods and UPLC-MS/MS, this study identified 1,945 metabolites in B. striata extracts. The dominant categories were lipids (51.35%), flavonoids (18.00%), and phenolic acids (12.51%). KEGG analysis revealed alterations in flavonoids and isoflavonoids biosynthesis pathways. Thirteen bitter metabolites, including cinnamic acid, were identified in B. striata tubers, underscoring their potential pharmacological applications, such as anti-inflammatory, antioxidant and antibacterial activities. Optimizing different extraction methods can better preserve the bioactive components of B. striata extracts, thereby enhancing its potential applications in the food and pharmaceutical industries.

10.1016/j.ultsonch.2025.107266

Cite

Citations (0)

O1-conotoxin Tx6.7 cloned from the genomic DNA of Conus textile that inhibits calcium currents

The Journal of venomous animals and toxins including tropical diseases (2023)

Maojun Zhou Manyi Yang Hui‐Ling Wen Shun Xu Cuifang Han

Conotoxins exhibit great potential as neuropharmacology tools and therapeutic candidates due to their high affinity and specificity for ion channels, neurotransmitter receptors or transporters. The traditional methods to discover new conotoxins are peptide purification from the crude venom or gene amplification from the venom duct.In this study, a novel O1 superfamily conotoxin Tx6.7 was directly cloned from the genomic DNA of Conus textile using primers corresponding to the conserved intronic sequence and 3' UTR elements. The mature peptide of Tx6.7 (DCHERWDWCPASLLGVIYCCEGLICFIAFCI) was synthesized by solid-phase chemical synthesis and confirmed by mass spectrometry.Patch clamp experiments on rat DRG neurons showed that Tx6.7 inhibited peak calcium currents by 59.29 ± 2.34% and peak potassium currents by 22.33 ± 7.81%. In addition, patch clamp on the ion channel subtypes showed that 10 μM Tx6.7 inhibited 56.61 ± 3.20% of the hCaV1.2 currents, 24.67 ± 0.91% of the hCaV2.2 currents and 7.30 ± 3.38% of the hNaV1.8 currents. Tx6.7 had no significant toxicity to ND7/23 cells and increased the pain threshold from 0.5 to 4 hours in the mouse hot plate assay.Our results suggested that direct cloning of conotoxin sequences from the genomic DNA of cone snails would be an alternative approach to obtaining novel conotoxins. Tx6.7 could be used as a probe tool for ion channel research or a therapeutic candidate for novel drug development.

Conotoxin

Conus

genomic DNA

10.1590/1678-9199-jvatitd-2022-0085

Cite

Citations (3)

Survey of Natural Language Processing Techniques in Bioinformatics

Computational and Mathematical Methods in Medicine (2015)

Zhiqiang Zeng Hua Shi Yun Wu Zhiling Hong

Informatics methods, such as text mining and natural language processing, are always involved in bioinformatics research. In this study, we discuss text mining and natural language processing methods in bioinformatics from two perspectives. First, we aim to search for knowledge on biology, retrieve references using text mining methods, and reconstruct databases. For example, protein-protein interactions and gene-disease relationship can be mined from PubMed. Then, we analyze the applications of text mining and natural language processing techniques in bioinformatics, including predicting protein structure and function, detecting noncoding RNA. Finally, numerous methods and applications, as well as their contributions to bioinformatics, are discussed for future use by text mining and natural language processing researchers.

Biomedical text mining

Concept mining

Text processing

10.1155/2015/674296

Cite

Citations (60)

Molecular characterization of Salmonella enterica serovar Enteritidis on retail raw poultry in six provinces and two National cities in China

Food Microbiology (2014)

Yin Wang Baowei Yang Yun Wu Zengfeng Zhang Xiaofeng Meng

Quinolone

Salmonella enteritidis

Gene cassette

10.1016/j.fm.2014.07.012

Cite

Citations (42)

Characterizing the evolution and functions of the M-superfamily conotoxins

Toxicon (2013)

Maojun Zhou Lei Wang Yun Wu Xiaoyan Zhu Yuchao Feng

Conotoxin

Conus

Conserved sequence

10.1016/j.toxicon.2013.09.020

Cite

Citations (27)

Discovery and characterization of the novel conotoxin Lv1d from Conus lividus that presents analgesic activity

Toxicon (2021)

Yuanyuan Qiang Yun Wu Di Zhao Boyao Zhao Feng Wang

Conotoxin

Conus

10.1016/j.toxicon.2021.02.003

Cite

Citations (5)

Predicting Human Enzyme Family Classes by Using Pseudo Amino Acid Composition

Current Proteomics (2016)

Yun Wu Hua Tang Wei Chen Hao Lin

Background: Enzymes are biological macromolecules which can act as catalysts and help complex biochemical reactions. They can increase the rate of a reaction by reducing its activation energy. Different enzymes can catalyze different chemical reactions. Objective: With the appearance of vast human protein data, correctly identifying the human enzymes class is extremely important to understand their functions. However, no computational method was developed to predict enzyme functional classes in human. We aimed to develop a computational method to discriminate human enzymes from non-enzymes and further predict the classes of human enzymes. Method: In this paper, the pseudo amino acid composition was proposed to formulate proteins by incorporating rigidity, flexibility and irreplaceability of amino acids. The feature selection technique was used to optimize the feature set. We proposed SVM to perform prediction. Results: The results of five-fold cross-validation test show that the overall accuracies are 72.6% and 46.1%, respectively for discriminating human enzymes from non-enzymes and predicting six classes of human enzymes. Conclusion: The work in this study provides an efficient method on this issue. Especially, three kinds of new characteristics were introduced to incorporate into PseAAC. The results indicate that the three characteristics of amino acids can be used in human enzyme prediction. Keywords: Human enzyme, pseudo amino acid composition, rigidity, flexibility, irreplaceability.

10.2174/157016461302160514003437

Cite

Citations (11)